Switch to Europe/Worldwide website Switch to German website Switch to French website Switch to OriGene Technologies, Inc. (North America)
Home » ESAM

AR26005PU-N ESAM (His-tag)

Search for all "ESAM"

20 µg / €200.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

ESAM

AR26005PU-N

Product Description for ESAM

ESAM.
Presentation: Purified

Properties for ESAM

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms Endothelial cell-selective adhesion molecule
Presentation Purified
Molecular weight 27,80 kDa
Source E. coli
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AP7
Purity > 95 % by SDS-PAGE and silver stain
Add. information Protein RefSeq: NP_620411.2
mRNA RefSeq: NM_138961.2
Background Endothelial cellselective adhesion molecule (ESAM) is a 55 kDa type I transmembrane glycoprotein that belongs to the JAM family of immunoglobulin superfamily molecules. Human ESAM is synthesized as a 390 amino acid (aa) protein composed of a 29 aa signal peptide, a 216 aa extracellular region, a putative 26 aa transmembrane segment, and a 119 aa cytoplasmic domain. The extracellular region contains one V-type and one C2-type Ig domain and is involved in hemophilic adhesion. In the cytoplasmic domain, there is a docking site for the multifunctional adaptor protein MAGI1. The extracellular region of human ESAM shows 90%, 74%, 69% and 67% aa identity with monkey, canine, mouse and rat extracellular ESAM, respectively. ESAM is expressed on endothelial cells, activated platelets and megakaryocytes, and can be found associated with cell to cell junctions. Whether ESAM is restricted to a particular junctional type is not clear. ESAM deficient mice have no defect in vascularization but do have reduced angiogenic potential. This may be due to a decreased migratory response to FGF2.
Soluble ESAM is fused to a C-terminal His-tag (6x His).
General Readings
  1. Hirata et al, J Biol Chem 276 (2001).
  2. Nasdala et al, J Biol Chem 277 (2002).
  3. Wegmann et al, Exp Cell Res 300 (2004).
  4. Ishida et al, J Biol Chem 278 (2003).
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Human recombinant ESAM (fragment), aa. 255
AA Sequence:
ISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQ KEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVVQDKQGKSRGHSIKTLELNVLVPPA PPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEV GTAQCNVTLEVSTGPGARSHHHHHH
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng/µg of CCM-3
Purity:
>95% by SDS-PAGE and silver stain
State:
Lyophilized protein
Purified
Reconstitution:
Human ESAM should be restored in sterile water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Compare Products

You have no items to compare.

My Cart

You have no items in your shopping cart.

Service
  • OriGene Technologies GmbH
  • Schillerstraße 5
  • D-32052 Herford
  • Germany
  • phone: +49-5221-34606-0
  • free call: 0800-227 47 46 (Germany only)
  • fax: +49-5221-34606-11
  • email: info-de@origene.com
  • orders: ordering-de@origene.com
 
© Copyright 1998 - 2018 OriGene Technologies GmbH
  • LinkedIn