AR26011PU-L Placenta growth factor / PGF

Search for all "Placenta growth factor / PGF"

20 µg / €490.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Placenta growth factor / PGF

AR26011PU-L

More Views

  • AR26011PU-L

Product Description for Placenta growth factor / PGF

Placenta growth factor / PGF.
Presentation: Purified

Properties for Placenta growth factor / PGF

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms PGFL, PLGF, PlGF
Presentation Purified
Molecular weight ~ 40 kDa
Source Insect cells
Species (Protein) Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P49764
Purity > 95 % by SDS-PAGE and silver stain
Add. information There are two equal forms, (i) Ala24 to Pro158 and (ii) Ala27 to Pro158.
Protein RefSeq: NP_032853
mRNA RefSeq: NM_008827
Background Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF1, PlGF2 and PlGF3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
General Readings
  1. DiPalma, T. et al. (1996) Mamm. Genome 7:6.
  2. Cao, Y. et al. (1997) Biochem. Biophys. Res. Commun. 235:493.
  3. Ferrara, N. et al. (1997) Endocrin. Rev. 18:4.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Mouse recombinant Placenta Growth Factor, aa. 135 / 132 
Result by N-terminal sequencing: ALSAGNNSTE and AGNNSTE
AA Sequence:
ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANIT MQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNQTEEPHP
Biological activity:
Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
Molecular weight:
(Dimer, 135 / 132)
Format
Buffer System:
25 mM Tris, 75 mM NaCl pH 8.5
Stabilizers:
BSA
Endotoxin level:
< 0.1 ng per μg of PIGF
Purity:
>95% by SDS-PAGE and silver stain
State:
Lyophilized protein
Purified
Reconstitution:
PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM Acetic Acid or PBS/water. This solution can be diluted into other buffered solutions.
  • LinkedIn