AR26016PU-N VEGF-A (VEGF188)

Search for all "VEGF-A"

5 µg / €240.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGF-A

AR26016PU-N

More Views

  • AR26016PU-N

Product Description for VEGF-A

VEGF-A.
Presentation: Purified

Properties for VEGF-A

Product Category Proteins & Growth Factors
Quantity 5 µg
Synonyms VEGF, VEGFA, VPF, Vascular endothelial growth factor A, Vascular permeability factor
Presentation Purified
Molecular weight 44.2 kDa
Source E. coli
Species (Protein) Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q00731
Purity > 95 % by SDS-PAGE and silver stain
Add. information Protein RefSeq: NP 001020421
mRNA RefSeq: NM 001025250
Background Mouse Vascular Endothelial Growth Factor188 (VEGF188), a 22,1 kDa protein consisting of 188 amino acid residues, is produced as a homodimer. VEGF188 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo.
Two high-affinity tyrosine kinase receptors for VEGF188 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF188, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120 VEGF144, and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated.
In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogeneity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exists and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.
General Readings
  1. Breier G, Albrecht U, Sterrer S, Risau W. Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation. Development. 1992 Feb;114(2):521-32. PubMed PMID: 1592003.
  2. Fiebich BL, Jäger B, Schöllmann C, Weindel K, Wilting J, Kochs G, et al. Synthesis and assembly of functionally active human vascular endothelial growth factor homodimers in insect cells. Eur J Biochem. 1993 Jan 15;211(1-2):19-26. PubMed PMID: 7678805.
  3. Flamme et al., Dev Biol 162:699, 1995.
  4. Kremer C, Breier G, Risau W, Plate KH. Up-regulation of flk-1/vascular endothelial growth factor receptor 2 by its ligand in a cerebral slice culture system. Cancer Res. 1997 Sep 1;57(17):3852-9. PubMed PMID: 9288799.
  5. Kanthou C, Dachs GU, Lefley DV, Steele AJ, Coralli-Foxon C, Harris S, et al. Tumour cells expressing single VEGF isoforms display distinct growth, survival and migration characteristics. PLoS One. 2014 Aug 13;9(8):e104015. doi: 10.1371/journal.pone.0104015. eCollection 2014. PubMed PMID: 25119572. (Free PMC Article available, 9 images available)
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Murine Vascular Endothelial Growth Factor188. 
Result by N-terminal sequencing: APTTEGE
AA Sequence:
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNIT MQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKKKSRFKSWSVHCEPCSERRKHLFVQ DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Biological activity:
Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-20 ng/ml.
Format
Buffer System:
50 mM Acetic Acid
Stabilizers:
None
Endotoxin level:
< 0.1 ng/µg of VEGF188
Purity:
>95% by SDS-PAGE and silver stain
State:
Lyophilized protein
Purified
Reconstitution:
The lyophilized VEGF188 should be reconstituted in 50mM Acetic Acid or medium containing at least 0.1% Human or BSA to a concentration not lower than 50 μg/ml.
  • LinkedIn