BM6025P CD49c / ITGA3 (3B Isoform specific) antibody

See related secondary antibodies

Search for all "CD49c / ITGA3"

0.1 mg / €370.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CD49c / ITGA3 54B3

BM6025P

Product Description for CD49c / ITGA3

Mouse anti Human CD49c / ITGA3 54B3.
Properties: (3B Isoform specific)
Presentation: Purified
Product is tested for Frozen Sections, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for CD49c / ITGA3

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3
Presentation Purified
Reactivity Hu
Applications C, ICC/IF, WB
Clonality Monoclonal
Clone 54B3
Host Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Monoclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P26006
Immunogen:
Synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin α3B including an appending N-terminal cysteine coupled to keyhole limpet hemocyanin.
AA Sequence:
CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK
GeneID:
3675
Property 3B Isoform specific
Isotype control AM03095PU-N, SM10P (for use in human samples)
Application Immunoblotting: 1/100-1/1000.
Immunocytochemistry.
Immunohistochemistry on Frozen Sections: 1/25-1/200, with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent.
Background Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
Concentration 1.0 mg/ml
General Readings
  1. de Melker AA, Sterk LM, Delwel GO, Fles DL, Daams H, Weening JJ, et al. The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization. Lab Invest. 1997 Apr;76(4):547-63. PubMed PMID: 9111516.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Buffer System:
PBS
Preservatives:
0.09% Sodium Azide
State:
Liquid purified IgG fraction
Purified
Specificity
Specificity:
54B3 recognizes specifically the cytoplasmic domain of integrin subunit a3B which is present in microvascular structures in brain and heart.
Species:
Human.
Gene ID 3675

Accessory Products

Proteins and/or Positive Controls

Proteins for CD49c / ITGA3 (1 products)

Catalog No. Species Pres. Purity   Source  

CD49c / ITGA3 (transcript variant b)

CD49c / ITGA3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for CD49c / ITGA3 (3 products)

Catalog No. Species Pres. Purity   Source  

Integrin alpha 3 Lysate

Western Blot: Integrin alpha 3 Lysate [NBL1-12063] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ITGA3
  Novus Biologicals Inc.

ITGA3 overexpression lysate

ITGA3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ITGA3 overexpression lysate

ITGA3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn