AR31053PU-S VEGF-A (VEGF120)

Search for all "VEGF-A"

2 µg / €180.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGF-A

Product Description for VEGF-A

VEGF-A.
Presentation: Purified

Properties for VEGF-A

Product Category Proteins & Growth Factors
Quantity 2 µg
Synonyms VEGF, VEGFA, VPF, Vascular endothelial growth factor A, Vascular permeability factor
Presentation Purified
Molecular weight 14.02 kDa
Source E. coli
Species (Protein) Rat
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P16612
Purity > 95 %
Background Rat Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts.
In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.
The full ORF of native rat VEGF120 (Ala27-Arg146) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols.
General Readings
  1. Breier et al., Dev 114:521, 1992
  2. Fiebig et al., Eur J Biochem 211:19, 1993
  3. Flamme et al., Dev Biol 162:699, 1995
  4. Kremer at al., Cancer Res 57:3852, 1997
Storage Lyophilized samples are stable for greater than six months at –20°C to –70°C.
Reconstituted VEGF120 should be stored in working aliquots at -20°C.
Avoid repeated freeze-thaw cycles!
Description
Description:
Recombinant Rat Vascular Endothelial Growth Factor 120
AA Sequence:
APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVT MQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Result by N-terminal sequencing: APTTEGEQKAH
Biological activity:
Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.
Molecular weight:
(120 amino acids)
Format
Buffer System:
PBS without stabilizer
Endotoxin level:
< 0.1 ng/µg of Rat VEGF120
Purity:
>95%
State:
Lyophilized freeze dried protein
Purified
Reconstitution:
The lyophilized VEGF120 should be restored in ddH2O to a concentration not lower than 50 μg/ml.
  • LinkedIn