AR31055PU-L FGF basic / FGF2

Search for all "FGF basic / FGF2"

50 µg / €260.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

FGF basic / FGF2

AR31055PU-L

More Views

  • AR31055PU-L

Product Description for FGF basic / FGF2

FGF basic / FGF2.
Presentation: Purified

Properties for FGF basic / FGF2

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms BFGF, FGFB, Fibroblast growth factor 2 (basic), HBGF-2, HBGF2, Heparin-binding growth factor 2
Presentation Purified
Molecular weight 16.34 kDa
Source E. coli
Species (Protein) Rat
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P13109
Purity > 98 %
Background The FGF family is composed of at least 23 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HB-GF). Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms were used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups.
Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16.5kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thought to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125kDa and 145kDa receptor species. However, acidic FGF has a higher affinity for the 125kDa species, while basic FGF has a higher affinity for the 145kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF’s induce the proliferative response in cells derived from mesoderm and neuroectoderm. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis.
General Readings
  1. Hisaoka K et al, J Biol Chem 286, 2011
  2. Florkiewicz RZ et al, Biochem Biophys Res Commun 409, 2011
  3. Sun Y et al, J Cell Sci 124, 2011
  4. Turner CA et al, Proc Natl Acad Sci 108, 2011
  5. Eckenstein FP et al, Biochem Pharmacol 47, 1994
  6. el-Husseini AE, Biochim Biophys Acta 1131, 1992
  7. Fujimoto K et al, Biochem Biophys Res Commun 180, 1991
  8. Shimasaki S et al, Biochem Biophys Res Commun 157, 1988
  9. Kurokawa et al, Nucleic Acids Res 16, 1988
Storage The lyophilized Rat FGF-2, though stable at room temperature, is best stored in working aliquots at –20°C to –70°C.
Avoid repeated freeze-thaw cycles!
Description
Description:
Recombinant Rat Fibroblast Growth Factor-2. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols.
AA Sequence:
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKE DGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKGPGQKAILFLPMSAKS
Result by N-terminal sequencing: ALPEDGGGAFPP
Biological activity:
The activity was determined by the stimulation of HUVE cells. The ED50 for this effect is ≤ 0.1ng/ml corresponding to a specific activity of ≥ 1 x 10e7 units/mg.
Molecular weight:
(145 amino acids)
Format
Buffer System:
0.5x PBS without stabilizers
Endotoxin level:
< 0.1ng per μg of Rat FGF-2
Purity:
>98%
State:
Lyophilized freeze dried protein without additives.
Purified
Reconstitution:
Restore with ddH2O at 50 μg/ml.
This solution can be diluted into other buffered solutions or stored frozen for future use.
  • LinkedIn