DA3510X Placenta growth factor / PGF (Isoform PlGF-2)

Search for all "Placenta growth factor / PGF"

20 µg / €490.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Placenta growth factor / PGF

DA3510X

Product Description for Placenta growth factor / PGF

Placenta growth factor / PGF.
Presentation: Purified

Properties for Placenta growth factor / PGF

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms PGFL, PLGF, PlGF
Presentation Purified
Molecular weight ~ 45 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P49763
Purity > 80 % pure by SDS-PAGE and visualised by silver stain.
Background Human Placenta Growth Factor-2 (PIGF-2), a 22 kDa protein consisting of 152 amino acid residues is produced as a homodimer. PlGF is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF acts only as a weak mitogen for those cell types possessing receptors for binding (e.g. vascular endothelial cells). At least one high-affinity receptor for PlGF (FLT -1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes). In addition to its action as a weak mitogen it is also a chemoattractant for monocytes and endothelial cells. Two different proteins are generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF -2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF is apparently a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation.
All dimeric forms posses similar biologcal activities. If PlGF is angiogenic in vivo is not clear. However, heterodimers between VEGF and PlGF are mitogenic for endothelial cells and have strong angiogenic activity in vivo (e.g. in the CAM assay or in the cornea pocket assay). Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A very related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Placenta Growth Factor-2 / PIGF-2. 
Result by N-terminal sequencing: LPAVPPQQWA 
Length (aa): 152
AA Sequence:
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHC VPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Biological activity:
Measured by its ability to bind to immobilized recombinant Human sFlt-1 in a functional ELISA.
Recombinant human PlGF-2 can bind to immobilized rh sFlt-1 (100 ng/well) with a linear range at 0.5-10 ng/ml.
Molecular weight:
(Dimer)
Format
Buffer System:
50 mM Acetic Acid with BSA (50-fold) as stabilizer.
Endotoxin level:
0.1 ng per µg of PIGF-2
Purity:
>80% pure by SDS-PAGE and visualised by silver stain.
State:
Lyophilized purified protein.
Purified
Reconstitution:
Restore with 50 mM Acetic Acid or PBS/Water. Centrifuge vial before opening!
  • LinkedIn