DA3519 VEGF-C / Flt4-L

Search for all "VEGF-C / Flt4-L"

5 µg / €200.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGF-C / Flt4-L

DA3519

More Views

  • DA3519

Product Description for VEGF-C / Flt4-L

VEGF-C / Flt4-L.
Presentation: Purified

Properties for VEGF-C / Flt4-L

Product Category Proteins & Growth Factors
Quantity 5 µg
Synonyms Flt4 ligand, VEGFC, VRP, Vascular endothelial growth factor C, Vascular endothelial growth factor-related protein
Presentation Purified
Molecular weight 15-20 kDa
Source Insect cells
Species (Protein) Rat
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
O35757
Purity > 90 % pure by SDS-PAGE and visualised by silver stain
Background VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.
General Readings
  1. Joukov et al., EMBO J 15:290, 1996
  2. Olofsson et al., Curr Opin Biotech 10:528, 1999
  3. Kukk et al., Development 122:3829, 1996
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
The recombinant Rat VEGF-C contains 115 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 15-20 kDa protein in SDS-PAGE under reducing conditions.
AA Sequence:
DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGY LSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIHHHHHH
Biological activity:
Determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
Molecular weight:
(127 aa)
Format
Buffer System:
50mM Acetic Acid
Stabilizers:
BSA
Endotoxin level:
< 0.1 ng per µg of VEGF-C
Purity:
>90% pure by SDS-PAGE and visualised by silver stain
State:
Lyophilized purified protein
Purified
Reconstitution:
The lyophilized VEGF-C is soluble in water and most aqueous buffers.
Restore in PBS or medium to a concentration not lower than 50 µg/ml.
  • LinkedIn