Switch to Europe/Worldwide website Switch to German website Switch to French website Switch to OriGene Technologies, Inc. (North America)
Home » LYVE-1

DA3524 LYVE-1

Search for all "LYVE-1"

20 µg / €200.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

LYVE-1

DA3524

Product Description for LYVE-1

LYVE-1.
Presentation: Purified

Properties for LYVE-1

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms CRSBP-1, CRSBP1, Cell surface retention sequence-binding protein 1, Extracellular link domain-containing protein 1, HAR, Hyaluronic acid receptor, LYVE1, Lymphatic vessel endothelial hyaluronic acid receptor 1, XLKD1
Presentation Purified
Molecular weight 45 kDa
Source Insect cells
Species (Protein) Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BHC0
Purity > 95 % by SDS-PAGE and visualised by silver stain
Background LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymphspecific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
General Readings
  1. Carriera et al., Cancer Res 61:8079, 2001
  2. Jackson DG Trends Cardiovasc Med 13:1, 2003
  3. Sleeman et al., Microsc Res Tech 55:61, 2001
  4. Mäkinen et al., EMBO J 20: 4762, 2001
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Mouse Soluble LYVE-1-His.
A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 - Gly228) was fused to a C-terminal His -tag (6xHis) and expressed in insect cells.
Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. 
Result by N-terminal sequencing: ADLVQDLS 
Length: 211 amino acids.
AA Sequence:
ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRI FSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTT PVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
Molecular weight:
sLYVE-1 has a calculated monomeric molecular mass of about 25kDa but as a result of glycosylation, migrates at approximately 35-45 kDa under reducing conditions in SDS-PAGE.
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg of VEGF-C
Purity:
>95% by SDS-PAGE and visualised by silver stain
State:
Lyophilized protein
Purified
Reconstitution:
Lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilised sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
Compare Products

You have no items to compare.

My Cart

You have no items in your shopping cart.

Service
  • OriGene Technologies GmbH
  • Schillerstraße 5
  • D-32052 Herford
  • Germany
  • phone: +49-5221-34606-0
  • free call: 0800-227 47 46 (Germany only)
  • fax: +49-5221-34606-11
  • email: info-de@origene.com
  • orders: ordering-de@origene.com
 
© Copyright 1998 - 2018 OriGene Technologies GmbH
  • LinkedIn