DA3534 VEGFR-1 / Flt-1 (Fc Chimera)

Search for all "VEGFR-1 / Flt-1"

10 µg / €170.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGFR-1 / Flt-1

DA3534

More Views

  • DA3534

Product Description for VEGFR-1 / Flt-1

VEGFR-1 / Flt-1.
Presentation: Purified

Properties for VEGFR-1 / Flt-1

Product Category Proteins & Growth Factors
Quantity 10 µg
Synonyms FLT, FLT1, FRT, Fms-like tyrosine kinase 1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, VEGF Receptor 1, VEGFR1, Vascular endothelial growth factor receptor 1, Vascular permeability factor receptor
Presentation Purified
Molecular weight 130 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P17948
Purity > 90 % by SDS-PAGE and visualised by silver stain.
Background Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs).
They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes. All VEGF-receptors have seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signalling activity. Mitogenic activity in endothelial cells is mainly mediated by VEGFR-2 leading to their proliferation. Differential splicing of the flt-1 gene leads to the formation of a secreted, soluble variant of VEGFR-1 (sVEGFR-1). No naturally occurring, secreted forms of VEGFR-2 have so far been reported. The binding of VEGF165 to VEGFR-2 is dependent on heparin.
General Readings
  1. Barleon B, Totzke F, Herzog C, Blanke S, Kremmer E, Siemeister G, et al. Mapping of the sites for ligand binding and receptor dimerization at the extracellular domain of the vascular endothelial growth factor receptor FLT-1. J Biol Chem. 1997 Apr 18;272(16):10382-8. PubMed PMID: 9099677.
  2. Roeckl W, Hecht D, Sztajer H, Waltenberger J, Yayon A, Weich HA. Differential binding characteristics and cellular inhibition by soluble VEGF receptors 1 and 2. Exp Cell Res. 1998 May 25;241(1):161-70. PubMed PMID: 9633524.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human soluble Vascular Endothelial Growth Factor Receptor-1 (sVEGFR-1D1-7) was fused with the Fc part of human IgG1. The recombinant mature sVEGFR-1D1-7/Fc is a disulfide-linked homodimeric protein. The sVEGFR-1D1-7/Fc monomers have a mass of approximately 130 kDa. The soluble receptor protein consists of all 7 extracellular domains (Met1-Thr751), which contain all the information necessary for high affinity ligand binding.
AA Sequence:
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHT GFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLI PDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTA TTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYD KAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTIL LSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDF CSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNG FHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQDSGTY ACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILG PGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTRSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Biological activity:
The activity of sVEGFR-1/Fc was determined by its ability to inhibit the VEGF-dependent proliferation of human umbilical vein endothelial cells.
The ED50 for this effect is typically 10-30 ng/ml.
Molecular weight:
(Monomer)
Format
Buffer System:
PBS, pH 7.4 without stabilizers.
Endotoxin level:
< 0.1 ng per ug of sVEGFR-1
Purity:
>90% by SDS-PAGE and visualised by silver stain.
State:
Lyophilized purified protein.
Purified
Reconstitution:
Restore in water or medium to a concentration not lower than 50 µg/ml.
The lyophilised sVEGFR-1/Fc is soluble in water and most aqueous buffers.
  • LinkedIn