DA3539 VEGFR-1 / Flt-1 (D1-D5)

Search for all "VEGFR-1 / Flt-1"

5 µg / €200.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

VEGFR-1 / Flt-1

DA3539

More Views

  • DA3539

Product Description for VEGFR-1 / Flt-1

VEGFR-1 / Flt-1.
Presentation: Purified

Properties for VEGFR-1 / Flt-1

Product Category Proteins & Growth Factors
Quantity 5 µg
Synonyms FLT, FLT1, FRT, Fms-like tyrosine kinase 1, Tyrosine-protein kinase FRT, Tyrosine-protein kinase receptor FLT, VEGF Receptor 1, VEGFR1, Vascular endothelial growth factor receptor 1, Vascular permeability factor receptor
Presentation Purified
Molecular weight 70 kDa
Source Insect cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P17948
Purity > 90 % pure by SDS-PAGE and Silver stain
Background Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin -like extracellular domains, a single transmembrane region and an intracellular splited tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly, a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVEC supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.
General Readings
  1. Röckl et al., Exp Cell Res 241:161-170.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinat Human soluble Vascular Endothelial Growth Factor Receptor-1 domain D1-5 (sVEGFR-1D1-5) is a 72 kDa protein containing amino acid residues. The baculovirus generated, recombinant Human sVEGFR-1 is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein contains only the first 5 extracellular domains, which contain all the information necessary for high affinity ligand binding. The receptor monomers have a mass of approximately 70kDa. 
Result by N-terminal sequencing: SGSKLKD
AA Sequence:
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHT GFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLI PDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTA TTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYD KAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTIL LSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDF CSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNG FHVN
Biological activity:
The activity of recombinant Human sVEGFR-1D1-5 was determined by its ability to to inhibit the VEGF-A-induced proliferation of HUVECs.
Molecular weight:
(536 amino acids, Monomer)
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per mg of VEGFR-1
Purity:
>90% pure by SDS-PAGE and Silver stain
State:
Lyophilized purified protein
Purified
Reconstitution:
The lyophilized sVEGFR-1D1-5 is soluble in water and most aqueous buffers and should be restored in PBS to a concentration not lower than 100 ng/ml.
  • LinkedIn