DA3558S Interleukin-1 beta / IL-1B

Search for all "Interleukin-1 beta / IL-1B"

2 µg / €150.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Interleukin-1 beta / IL-1B

DA3558S

More Views

  • DA3558S

Product Description for Interleukin-1 beta / IL-1B

Interleukin-1 beta / IL-1B.
Presentation: Purified

Properties for Interleukin-1 beta / IL-1B

Product Category Proteins & Growth Factors
Quantity 2 µg
Synonyms Catabolin, IL-1 beta, IL1 beta, IL1B, IL1F2
Presentation Purified
Molecular weight 17 kDa
Source E. coli
Specactivity 2 x
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH

Datasheet Extract

Immunogen
Swiss Prot Num:
P01584
Purity > 98 % pure by SDS-PAGE and Silver stain
Add. information Range: 0.1-10.0 ng/ml
Background Interleukin-1 beta (IL-1beta) is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL1F1) and IL1 beta (IL1F2), which are the products of distinct genes. IL- 1alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta converting enzyme (Caspase1/ICE) to generate the active cytokine. The mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67% 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta.
General Readings
  1. Allan SM, Tyrrell PJ, Rothwell NJ. Interleukin-1 and neuronal injury. Nat Rev Immunol. 2005 Aug;5(8):629-40. PubMed PMID: 16034365.
  2. Boraschi D, Tagliabue A. The interleukin-1 receptor family. Vitam Horm. 2006;74:229-54. PubMed PMID: 17027517.
  3. Kornman, K.S. (2006) Am. J. Clin. Nutr. 83:475S.
  4. Isoda K, Ohsuzu F. The effect of interleukin-1 receptor antagonist on arteries and cholesterol metabolism. J Atheroscler Thromb. 2006 Feb;13(1):21-30. PubMed PMID: 16505588.
  5. March CJ, Mosley B, Larsen A, Cerretti DP, Braedt G, Price V, et al. Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs. Nature. 1985 Jun 20-26;315(6021):641-7. PubMed PMID: 2989698.
  6. Auron PE, Webb AC, Rosenwasser LJ, Mucci SF, Rich A, Wolff SM, et al. Nucleotide sequence of human monocyte interleukin 1 precursor cDNA. Proc Natl Acad Sci U S A. 1984 Dec;81(24):7907-11. PubMed PMID: 6083565. (Free PMC Article available)
  7. Martinon F, Tschopp J. Inflammatory caspases and inflammasomes: master switches of inflammation. Cell Death Differ. 2007 Jan;14(1):10-22. Epub 2006 Sep 15. PubMed PMID: 16977329.
Storage Store lyophilized at RT for 3 weeks or (preferably in a desiccator) at -20°C for longer.
Following reconstitution store the antibody undiluted at 2-8°C for one week
or (in aliquots) at -20°C for longer.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA)
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Interleukin-1beta produced in E.Coli is a non-glycosylated, Interleukin-1 beta Polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa. 
Result by N-terminal sequencing: APVRSL and MAPVRS
AA Sequence:
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDD KPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQANMPVFLGGTKGGQDITDFTMQFVSS
Biological activity:
Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml.
Molecular weight:
(153 amino acids)
Format
Buffer System:
PBS
Stabilizers:
None
Endotoxin level:
< 0.1 ng per µg (IEU/µg) of rh IL-1beta
Purity:
>98% pure by SDS-PAGE and Silver stain
State:
Lyophilized purified protein
Purified
Reconstitution:
The lyophilized rh IL-1beta is soluble in water and most aqueous buffers.
The lyophilized powder can be restored in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.
  • LinkedIn