discontinued

AP42083PU-N IRX4 / IRXA3 antibody

See related secondary antibodies

Search for all "IRX4 / IRXA3"

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat, African clawed frog IRX4 / IRXA3

Product Description for IRX4 / IRXA3

Rabbit anti Bovine, Human, Mouse, Rat, African clawed frog IRX4 / IRXA3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for IRX4 / IRXA3

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Homeodomain protein IRXA3, IRX-4, Iroquois homeobox protein 4, Iroquois-class homeodomain protein IRX-4
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P78413
Immunogen:
The immunogen for anti-IRX4 antibody: synthetic peptide directed towards the N terminal of human IRX4.
AA Sequence:
SAAALGVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGL
GeneID:
50805
Application Western blotting (2 - 4 µg/ml)
Background IRX4 is likely to be an important mediator of ventricular differentiation during cardiac development.
General Readings Wang,G.F., (2001) J. Biol. Chem. 276 (31), 28835-28841
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on Protein A affinity column.
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, African clawed frog
Species reactivity (tested):
Human
Gene ID 50805

Accessory Products

Proteins and/or Positive Controls

Positive controls for IRX4 / IRXA3 (2 products)

Catalog No. Species Pres. Purity   Source  

IRX4 Lysate

Western Blot: IRX4 Lysate [NBL1-12041] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IRX4
  Novus Biologicals Inc.

IRX4 overexpression lysate

IRX4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn