discontinued

AP42099PU-N ZNF449 antibody

See related secondary antibodies

Search for all "ZNF449"

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat ZNF449

Product Description for ZNF449

Rabbit anti Bovine, Human, Mouse, Rat ZNF449.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF449

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ZSCAN19, Zinc finger and SCAN domain-containing protein 19, Zinc finger protein 449
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9G9
Immunogen:
The immunogen for anti-ZNF449 antibody: synthetic peptide directed towards the C terminal of human ZNF449.
AA Sequence:
GEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI
GeneID:
203523
Application Western blotting (0.2 - 1 µg/ml)
Background ZNF449 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 SCAN box domain. ZNF449 may be involved in transcriptional regulation.
General Readings Luo,K., (2006) Mol. Biol. Rep. 33 (1), 51-57
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine
Species reactivity (tested):
Human
Gene ID 203523

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF449 (6 products)

Catalog No. Species Pres. Purity   Source  

ZNF449 (full length, N-term HIS tag)

ZNF449 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF449

ZNF449 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF449

ZNF449 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF449

ZNF449 Human Purified
  Abnova Taiwan Corp.

ZNF449

ZNF449 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF449

ZNF449 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF449 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF449 293T Cell Transient Overexpression Lysate(Denatured)

ZNF449 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF449 Lysate

Western Blot: ZNF449 Lysate [NBL1-18158] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF449
  Novus Biologicals Inc.
  • LinkedIn