discontinued

AP42041PU-N ZFP1 antibody

See related secondary antibodies

Search for all "ZFP1"

Quick Overview

Rabbit anti Canine, Human, Mouse ZFP1

AP42041PU-N

More Views

  • AP42041PU-N
  • AP42041PU-N

Product Description for ZFP1

Rabbit anti Canine, Human, Mouse ZFP1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZFP1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Zfp-1, Zinc finger protein 1 homolog
Presentation Aff - Purified
Reactivity Can, Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P2D0
Immunogen:
The immunogen for anti-ZFP1 antibody: synthetic peptide directed towards the N terminal of human ZFP1
AA Sequence:
SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
GeneID:
162239
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background Zinc finger proteins (Zfp) are encoded by a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers. The putative Zfp-1 (Zinc finger protein 1 homolog) protein contains in addition to 7 zinc fingers, two helix-turn-helix motifs.
General Readings Chowdhury,K., et al., (1989) NucleicAcidsRes.17(24),10427-10438
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Dog
Species reactivity (tested):
Human
Gene ID 162239

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFP1 (2 products)

Catalog No. Species Pres. Purity   Source  

ZFP1

ZFP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFP1

ZFP1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZFP1 (2 products)

Catalog No. Species Pres. Purity   Source  

ZFP1 293T Cell Transient Overexpression Lysate(Denatured)

ZFP1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZFP1 overexpression lysate

ZFP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn