discontinued

AP43147PU-N ATP5G2 antibody

See related secondary antibodies

Search for all "ATP5G2"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog ATP5G2

Product Description for ATP5G2

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog ATP5G2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ATP5G2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ATP synthase lipid-binding protein, ATP synthase proteolipid P2, ATPase protein 9, ATPase subunit c, mitochondrial ATP synthase F(0) complex subunit C2, mitochondrial ATP synthase lipid-binding protein
Presentation Purified
Reactivity African clawed frog, Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q06055
Immunogen:
Synthetic peptide directed towards the N terminal of human ATP5G2
AA Sequence:
SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA
GeneID:
517
Application Western blotting (0.2 - 1 µg/ml)
Background ATP5G2 is a subunit of mitochondrial ATP synthase. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. ATP5G2 is one of three precursors of subunit c.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). There are three separate genes which encode subunit c of the proton channel and they specify precursors with different import sequences but identical mature proteins. The protein encoded by this gene is one of three precursors of subunit c. Alternatively spliced transcript variants encoding different isoforms have been identified. This gene has multiple pseudogenes.
General Readings
  1. Kohler,A., (2004) Nature 427 (6973), 407-408
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purified
Species Reactivity
Species reactivity (expected):
Rat, Pig, Rabbit, Bovine
Species reactivity (tested):
Human
Gene ID 517

Accessory Products

Proteins and/or Positive Controls

Proteins for ATP5G2 (2 products)

Catalog No. Species Pres. Purity   Source  

ATP5G2

ATP5G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ATP5G2

ATP5G2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn