discontinued

AP43529PU-N AGXT2L2 antibody

See related secondary antibodies

Search for all "AGXT2L2"

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat AGXT2L2

Product Description for AGXT2L2

Rabbit anti Bovine, Human, Mouse, Rat AGXT2L2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AGXT2L2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Alanine-glyoxylate aminotransferase 2-like 2, PP9286
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IUZ5
Immunogen:
Synthetic peptide directed towards the N terminal of human AGXT2L2
AA Sequence:
QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL
GeneID:
85007
Application Western blotting (0.2 - 1.0 µg/ml)
Background This enzyme catalyzes the pyridoxal-phosphate-dependent breakdown of 5-phosphohydroxy-L-lysine, converting it to ammonia, inorganic phosphate and 2-aminoadipate semialdehyde. It is a homotetramer of 50 kDa units and belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
General Readings "Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine." Veiga-da-Cunha M., Hadi F., Balligand T., Stroobant V., Van Schaftingen E. J. Biol. Chem. 287:7246-7255(2012)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Rabbit
Species reactivity (tested):
Human
Gene ID 85007

Accessory Products

Proteins and/or Positive Controls

Proteins for AGXT2L2 (4 products)

Catalog No. Species Pres. Purity   Source  

AGXT2L2

AGXT2L2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

AGXT2L2

AGXT2L2 Human Purified
  Abnova Taiwan Corp.

AGXT2L2

AGXT2L2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AGXT2L2

AGXT2L2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AGXT2L2 (3 products)

Catalog No. Species Pres. Purity   Source  

AGXT2L2 293T Cell Transient Overexpression Lysate(Denatured)

AGXT2L2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

AGXT2L2 Lysate

Western Blot: AGXT2L2 Lysate [NBL1-07401] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AGXT2L2 Protein
  Novus Biologicals Inc.

PHYKPL overexpression lysate

PHYKPL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn