discontinued

AP45136PU-N ARNTL2 / BMAL2 (C-term) antibody

See related secondary antibodies

Search for all "ARNTL2 / BMAL2"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ARNTL2 / BMAL2

Product Description for ARNTL2 / BMAL2

Rabbit anti Bovine, Canine, Human, Mouse, Rat ARNTL2 / BMAL2.
Properties: (C-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ARNTL2 / BMAL2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Aryl hydrocarbon receptor nuclear translocator-like protein 2, BHLHE6, Basic-helix-loop-helix-PAS protein MOP9, Brain and muscle ARNT-like 2, CLIF, CYCLE-like factor, Class E basic helix-loop-helix protein 6, MOP9, Member of PAS protein 9, PAS domain-containing protein 9, PASD9, bHLHe6
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2VPD4
Immunogen:
Synthetic peptide directed towards the middle regionl of mouse ARNTL2
AA Sequence:
AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV
GeneID:
272322
Property C-term
Application Western blotting (0.2 -1 µg/ml).
Background ARNTL2-CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, ARNTL2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1. It is xxpressed in fetal brain and highly expressed in brain and placenta. Lower levels are found in heart, liver, thymus, kidney and lung. It is located to endothelial cells and neuronal cells of the suprachiasmatic nucleus (SCN) and also detected in endothelial cells of the heart, lung and kidney. In the brain, it is specifically expressed in the thalamus, hippocampus and amygdala.
General Readings "CLIF, a novel cycle-like factor, regulates the circadian oscillation of plasminogen activator inhibitor-1 gene expression." Maemura K., de La Monte S.M., Chin M.T., Layne M.D., Hsieh C.-M., Yet S.-F., Perrella M.A., Lee M.-E. J. Biol. Chem. 275:36847-36851(2000)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Rat, Human, Bovine, Dog
Species reactivity (tested):
Mouse
Gene ID 272322

Accessory Products

  • LinkedIn