discontinued

AP43042PU-N ZNF684 antibody

See related secondary antibodies

Search for all "ZNF684"

Quick Overview

Rabbit anti Human ZNF684

Product Description for ZNF684

Rabbit anti Human ZNF684.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF684

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Zinc finger protein 684
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 44 kDa (378 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T5D7
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF684
AA Sequence:
ANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNM
GeneID:
127396
Application Western blotting: 0.2 - 1.0 µg/ml.
Background Zinc finger protein 684, belonging to the krueppel C2H2-type zinc-finger protein family, contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF684 may be involved in transcriptional regulation.
Concentration 1.0 mg/ml
General Readings Gregory,S.G., (2006) Nature 441 (7091), 315-321.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 127396

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF684 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF684 (full length, N-term HIS tag)

ZNF684 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF684

ZNF684 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF684

ZNF684 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF684 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF684 293T Cell Transient Overexpression Lysate(Denatured)

ZNF684 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF684 Lysate

Western Blot: ZNF684 Lysate [NBL1-18226] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF684.
  Novus Biologicals Inc.
  • LinkedIn