GTDC2 / AGO61

Product Description for GTDC2 / AGO61

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat GTDC2 / AGO61.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 mg
Synonyms	C3orf39, Extracellular O-linked N-acetylglucosamine transferase-like, Glycosyltransferase-like domain-containing protein 2, chromosome 3 open reading frame 39
Presentation	Aff - Purified
Reactivity	Bov, Can, Chk, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q8NAT1 Immunogen: Synthetic peptide directed towards the middle region of human GTDC2 AA Sequence: `TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN` GeneID: 84892
Application	Western blotting (1 - 3 µg/ml)
Background	AGO61 or GTDC2 shows Glycosyltransferase activity: UDP-N-acetyl-D-glucosamine + [protein]-L-serine = UDP + [protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine.
General Readings	Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Purified using Protein A affinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (expected): Mouse, Rat, Dog, Bovine, Chicken Species reactivity (tested): Human
Gene ID	84892

Catalog No.	Species	Pres.	Purity	Source
TP309307	GTDC2 / AGO61
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00084892-P01-10	GTDC2 / AGO61
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00084892-P01-25	GTDC2 / AGO61
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.

Catalog No.	Species	Purity
H00084892-T01	C3orf39 293T Cell Transient Overexpression Lysate(Denatured)

			Abnova Taiwan Corp.
NBL1-08447	C3orf39 Lysate
		Protein
			Novus Biologicals Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH