discontinued

AP45021PU-N ZNF692 (N-term) antibody

See related secondary antibodies

Search for all "ZNF692"

Quick Overview

Rabbit anti Human ZNF692

Product Description for ZNF692

Rabbit anti Human ZNF692.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF692

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Zinc finger protein 692
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 57 kDa (519 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BU19
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF692
AA Sequence:
GGHMEQWCLLKERLGFSLHSQLAKFLLDRYTSSGCVLCAGPEPLPPKGLQ
GeneID:
55657
Property N-term
Application Western blotting: 0.2 - 1.0 µg/ml.
Background Zinc finger protein 692, belonging to the krueppel C2H2-type zinc-finger protein family, contains 5 C2H2-type zinc fingers and may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Ota, T., (2004) Nat. Genet. 36: 40-45.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Bovine, Horse, Dog, Rabbit, Guinea pig, Chicken
Species reactivity (tested):
Human
Gene ID 55657

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF692 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF692 (transcript variant 2)

ZNF692 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF692

ZNF692 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF692

ZNF692 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF692 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF692 Lysate

Western Blot: ZNF692 Lysate [NBL1-18231] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF692
  Novus Biologicals Inc.

ZNF692 overexpression lysate

ZNF692 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF692 overexpression lysate

ZNF692 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn