discontinued

AP46143PU-N LRRC23 (Center) antibody

See related secondary antibodies

Search for all "LRRC23"

Quick Overview

Rabbit anti Human LRRC23

Product Description for LRRC23

Rabbit anti Human LRRC23.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRC23

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LRPB7, Leucine-rich protein B7, Leucine-rich repeat-containing protein 23
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight LRRC23: 40 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53EV4
Immunogen:
Synthetic peptide directed towards the middle region of human LRRC23
AA Sequence:
ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH
GeneID:
10233
Property Center
Application Western blotting (0.2 - 1 µg/ml).
Background LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 10233

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRC23 (3 products)

Catalog No. Species Pres. Purity   Source  

LRRC23 (transcript variant 1)

LRRC23 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LRRC23

LRRC23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LRRC23

LRRC23 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LRRC23 (2 products)

Catalog No. Species Pres. Purity   Source  

B7 293T Cell Transient Overexpression Lysate(Denatured)

B7 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRC23 Lysate

Western Blot: LRRC23 Lysate [NBL1-12681] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LRRC23
  Novus Biologicals Inc.
  • LinkedIn