TUBG2 / Tubulin gamma 2 (Center) - AP46161PU-N

Product Description for TUBG2 / Tubulin gamma 2

Rabbit anti Human TUBG2 / Tubulin gamma 2.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	50 µg
Synonyms	Gamma-2-tubulin, Tubulin gamma 2, Tubulin gamma-2 chain
Presentation	Aff - Purified
Reactivity	Hu
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Molecular weight	TUBG2: 51 kDa
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q9NRH3 Immunogen: Synthetic peptide directed towards the middle to C-terminal region of human TUBG2 AA Sequence: `FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI` GeneID: 27175
Property	Center
Application	Western blotting (0.2 - 1 µg/ml).
Background	Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (tested): Human.
Gene ID	27175

Catalog No.	Species	Purity	Source
TP311127	TUBG2 / Tubulin gamma 2
	Human	> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
				OriGene Technologies, Inc.
H00027175-Q01-10	TUBG2 / Tubulin gamma 2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.
H00027175-Q01-25	TUBG2 / Tubulin gamma 2
	Human	12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
				Abnova Taiwan Corp.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH