discontinued

AP46053PU-N UST / DS2ST (N-term) antibody

See related secondary antibodies

Search for all "UST / DS2ST"

Quick Overview

Rabbit anti Human UST / DS2ST

Product Description for UST / DS2ST

Rabbit anti Human UST / DS2ST.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for UST / DS2ST

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Uronyl 2-sulfotransferase
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight UST: 48 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2C2
Immunogen:
Synthetic peptide directed towards the N-terminal region of human UST
AA Sequence:
PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
GeneID:
10090
Property N-term
Application

Western blotting  (0.2 - 1 µg/ml).

Background UST catalyzes the transfer of sulfate to the position 2 of uronyl residues. UST has mainly activity toward iduronyl residues in dermatan sulfate, and weaker activity toward glucuronyl residues of chondroitin sulfate. It has no activity toward desulfated N-resulfated heparin.
General Readings "Molecular cloning and characterization of a human uronyl 2-sulfotransferase that sulfates iduronyl and glucuronyl residues in dermatan/chondroitin sulfate." Kobayashi M., Sugumaran G., Liu J., Shworak N.W., Silbert J.E., Rosenberg R.D. J. Biol. Chem. 274:10474-10480(1999) [PubMed: 10187838]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 10090

Accessory Products

Proteins and/or Positive Controls

Positive controls for UST / DS2ST (2 products)

Catalog No. Species Pres. Purity   Source  

UST Lysate

Western Blot: UST Lysate [NBL1-17674] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for UST
  Novus Biologicals Inc.

UST overexpression lysate

UST overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn