AP46055PU-N SCARA3 (Center) antibody

See related secondary antibodies

Search for all "SCARA3"

0.1 ml / €430.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse SCARA3

Product Description for SCARA3

Rabbit anti Human, Mouse SCARA3.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SCARA3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CSR, Cellular stress response gene protein, Scavenger receptor class A member 3
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight SCARA3: 65 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8C850
Immunogen:
Synthetic peptide corresponding to the middle region of mouse Scara3
AA Sequence:
KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH
GeneID:
219151
Property Center
Application

Western blotting  (1 µg/ml).

Background SCARA3 seems to protect cells by scavenging oxidative molecules or harmful products of oxidation.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.
Gene ID 219151

Accessory Products

  • LinkedIn