AP46009PU-N RFWD2 / RNF200 (Center) antibody

See related secondary antibodies

Search for all "RFWD2 / RNF200"

0.1 ml / €430.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse RFWD2 / RNF200

Product Description for RFWD2 / RNF200

Rabbit anti Human, Mouse RFWD2 / RNF200.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RFWD2 / RNF200

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms COP1, Constitutive photomorphogenesis protein 1 homolog, E3 ubiquitin-protein ligase RFWD2, RING finger and WD repeat domain protein 2, RING finger protein 200
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RFWD2: 80 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9R1A8
Immunogen:
Synthetic peptide corresponding to a middle region of mouse
AA Sequence:
MSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGTSQTKKQPW
GeneID:
26374
Property Center
Application

Western blotting (0.2 - 1 µg/ml).

Background Rfwd2 is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It is involved in JUN ubiquitination and degradation and directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Rfwd2 probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1.
General Readings Evidence for functional conservation of a mammalian homologue of the light-responsive plant protein COP1." Wang H., Kang D., Deng X.-W., Wei N. Curr. Biol. 9:711-714(1999) [PubMed: 10395541] [Abstract]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human, mouse.
Gene ID 26374

Accessory Products

  • LinkedIn