discontinued

AP46130PU-N PIWIL4 (N-term) antibody

See related secondary antibodies

Search for all "PIWIL4"

Quick Overview

Rabbit anti Human PIWIL4

Product Description for PIWIL4

Rabbit anti Human PIWIL4.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PIWIL4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms HIWI2, MIWI2, PIWI, Piwi-like protein 4
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight PIWIL4: 96 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z3Z4
Immunogen:
Synthetic peptide directed towards the N-terminal of human PIWIL4
AA Sequence:
LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS
GeneID:
143689
Property N-term
Application Western blotting (0.2 - 1 µg/ml).
Background PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.
General Readings "The induction of H3K9 methylation by PIWIL4 at the p16Ink4a locus." Sugimoto K., Kage H., Aki N., Sano A., Kitagawa H., Nagase T., Yatomi Y., Ohishi N., Takai D. Biochem. Biophys. Res. Commun. 359:497-502 (2007) [PubMed: 17544373]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 143689

Accessory Products

Proteins and/or Positive Controls

Proteins for PIWIL4 (1 products)

Catalog No. Species Pres. Purity   Source  

PIWIL4

PIWIL4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for PIWIL4 (3 products)

Catalog No. Species Pres. Purity   Source  

PIWIL4 293T Cell Transient Overexpression Lysate(Denatured)

PIWIL4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PIWIL4 Lysate

Western Blot: PIWIL4 Lysate [NBL1-14452] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PITX4
  Novus Biologicals Inc.

PIWIL4 overexpression lysate

PIWIL4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn