SLC25A25 / SCAMC2 (N-term) - AP46027PU-N

Product Description for SLC25A25 / SCAMC2

Rabbit anti Human SLC25A25 / SCAMC2.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	50 µg
Synonyms	APC3, Calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896, MCSC3, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, SCAMC-2, Small calcium-binding mitochondrial carrier protein 2, Solute carrier family 25 member 25
Presentation	Aff - Purified
Reactivity	Hu
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Molecular weight	SLC25A25: 53 kDa
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q6KCM7 Immunogen: Synthetic peptide directed towards the N terminal of human SLC25A25 AA Sequence: `KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR` GeneID: 114789
Property	N-term
Application	Western blotting (0.2 - 1 µg/ml).
Background	Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
General Readings	"Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains." del Arco A., Satrustegui J. J. Biol. Chem. 279:24701-24713(2004) [PubMed: 15054102] [Abstract]
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (tested): Human.
Gene ID	114789

Catalog No.	Species	Pres.	Purity	Source
H00114789-P01-10	SLC25A25 / SCAMC2
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00114789-P01-25	SLC25A25 / SCAMC2
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00114789-Q01-10	SLC25A25 / SCAMC2
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00114789-Q01-25	SLC25A25 / SCAMC2
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species
H00114789-T01	SLC25A25 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY423537	SLC25A25 overexpression lysate
		0.1 mg / €495.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH