discontinued

AP46028PU-N SLC35A4 (Center) antibody

See related secondary antibodies

Search for all "SLC35A4"

Quick Overview

Rabbit anti Human SLC35A4

Product Description for SLC35A4

Rabbit anti Human SLC35A4.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35A4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Probable UDP-sugar transporter protein SLC35A4, Solute carrier family 35 member A4
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight SLC35A4: 34 kDa
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96G79
Immunogen:
Synthetic peptide directed towards the middle region of human SLC35A4
AA Sequence:
GLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLL
GeneID:
113829
Property Center
Application

Western blotting  (0.2 - 1 µg/ml).

Background SLC35A4, an integral membrane protein, belongs to the nucleotide-sugar transporter family. Its molecular function is described as sugar:hydrogen ion symporter activity.
General Readings "The nucleotide-sugar transporter family: a phylogenetic approach." Martinez-Duncker I., Mollicone R., Codogno P., Oriol R. Biochimie 85:245-260(2003) [PubMed: 12770764] [Abstract]
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 113829

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC35A4 (3 products)

Catalog No. Species Pres. Purity   Source  

SLC35A4

SLC35A4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SLC35A4

SLC35A4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SLC35A4

SLC35A4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SLC35A4 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC35A4 Lysate

Western Blot: SLC35A4 Lysate [NBL1-16117] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC35A4
  Novus Biologicals Inc.
  • LinkedIn