discontinued

AP45919PU-N APG4C / ATG4C antibody

See related secondary antibodies

Search for all "APG4C / ATG4C"

Quick Overview

Rabbit anti Human APG4C / ATG4C

Product Description for APG4C / ATG4C

Rabbit anti Human APG4C / ATG4C.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for APG4C / ATG4C

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AUT-like 3 cysteine endopeptidase, AUTL1, AUTL3, Autophagin-3, Autophagy-related cysteine endopeptidase 3, Autophagy-related protein 4 homolog C, Cysteine protease ATG4C
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96DT6
Immunogen:
Synthetic peptide directed towards the middle region of human ATG4C
AA Sequence:
TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS
GeneID:
84938
Application

Western blotting  (0.2 - 1 µg/ml).

Background Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. It is highly expressed in skeletal muscle, heart, liver and testis.
General Readings "Human autophagins, a family of cysteine proteinases potentially implicated in cell degradation by autophagy." Marino G., Uria J.A., Puente X.S., Quesada V., Bordallo J., Lopez-Otin C. J. Biol. Chem. 278:3671-3678(2003)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog
Species reactivity (tested):
Human.
Gene ID 84938

Accessory Products

Proteins and/or Positive Controls

Proteins for APG4C / ATG4C (5 products)

Catalog No. Species Pres. Purity   Source  

APG4C / ATG4C (transcript variant 8)

APG4C / ATG4C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

APG4C / ATG4C (transcript variant 7)

APG4C / ATG4C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

APG4C / ATG4C (transcript variant 7)

APG4C / ATG4C Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

APG4C / ATG4C

APG4C / ATG4C Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

APG4C / ATG4C

APG4C / ATG4C Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for APG4C / ATG4C (3 products)

Catalog No. Species Pres. Purity   Source  

ATG4C 293T Cell Transient Overexpression Lysate(Denatured)

ATG4C 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ATG4C Lysate

Western Blot: ATG4C Lysate [NBL1-07798] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ATG4C Protein
  Novus Biologicals Inc.

ATG4C overexpression lysate

ATG4C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn