discontinued

AP45671PU-N AKTIP / FTS antibody

See related secondary antibodies

Search for all "AKTIP / FTS"

Quick Overview

Rabbit anti Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog AKTIP / FTS

Product Description for AKTIP / FTS

Rabbit anti Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog AKTIP / FTS.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AKTIP / FTS

Product Category Primary Antibodies
Quantity 50 µg
Synonyms AKT-interacting protein, FT1, Fused toes protein homolog
Presentation Aff - Purified
Reactivity African clawed frog, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H8T0
Immunogen:
Synthetic peptide directed towards the middle region of human AKTIP
AA Sequence:
NPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEKTVA
GeneID:
64400
Application Western blotting (0.2 - 1.0 µg/ml)
Background AKTIP is the component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). AKTIP regulates apoptosis by enhancing phosphorylation and activation of AKT1. AKTIP increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade.The mouse homolog of this gene produces fused toes and thymic hyperplasia in heterozygous mutant animals while homozygous mutants die in early development. This gene may play a role in apoptosis as these morphological abnormalities are caused by altered patterns of programmed cell death. The protein encoded by this gene is similar to the ubiquitin ligase domain of other ubiquitin-conjugating enzymes but lacks the conserved cysteine residue that enables those enzymes to conjugate ubiquitin to the target protein. This protein interacts directly with serine/threonine kinase protein kinase B (PKB)/Akt and modulates PKB activity by enhancing the phosphorylation of PKB's regulatory sites. Alternative splicing results in two transcript variants encoding the same protein.
General Readings "Regulation of apoptosis by the Ft1 protein, a new modulator of protein kinase B/Akt." Remy I., Michnick S.W. Mol. Cell. Biol. 24:1493-1504(2004)
"An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex." Xu L., Sowa M.E., Chen J., Li X., Gygi S.P., Harper J.W. Mol. Biol. Cell 19:5059-5071(2008)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Chicken, Dog, African clawed frog, Zebrafish
Species reactivity (tested):
Human
Gene ID 64400

Accessory Products

Proteins and/or Positive Controls

Proteins for AKTIP / FTS (3 products)

Catalog No. Species Pres. Purity   Source  

AKTIP / FTS (transcript variant 2)

AKTIP / FTS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

AKTIP / FTS

AKTIP / FTS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

AKTIP / FTS

AKTIP / FTS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for AKTIP / FTS (2 products)

Catalog No. Species Pres. Purity   Source  

FTS 293T Cell Transient Overexpression Lysate(Denatured)

FTS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FTS Lysate

Western Blot: FTS Lysate [NBL1-07445] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AKTIP Protein
  Novus Biologicals Inc.
  • LinkedIn