ARMCX3 / ALEX3

Product Description for ARMCX3 / ALEX3

Rabbit anti Bovine, Canine, Human, Porcine, Rabbit ARMCX3 / ALEX3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	50 µg
Synonyms	ARM protein lost in epithelial cancers on chromosome X 3, Armadillo repeat-containing X-linked protein 3, BM-017
Presentation	Aff - Purified
Reactivity	Bov, Can, Hu, Por, Rb
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q9UH62 Immunogen: Synthetic peptide irected towards the middle region of human ARMCX3 AA Sequence: `LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE` GeneID: 51566
Application	Western blotting (0.2 -1 µg/ml).
Background	ARMC3 is a 42 kDa single-pass membrane protein containing 3 ARM repeats. The function of this protein remains unknown.
General Readings	"ALEX1, a novel human armadillo repeat protein that is expressed differentially in normal tissues and carcinomas." Kurochkin I.V., Yonemitsu N., Funahashi S., Nomura H. Biochem. Biophys. Res. Commun. 280:340-347(2001)
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Purified using peptide immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (expected): Bovine, Dog, Rabbit, Pig Species reactivity (tested): Human.
Gene ID	51566

Catalog No.	Species	Pres.	Purity	Source
TP317732	ARMCX3 / ALEX3 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00051566-P01	ARMCX3 / ALEX3
	Human	Purified
					Abnova Taiwan Corp.
H00051566-P01-25	ARMCX3 / ALEX3
	Human	Purified
					Abnova Taiwan Corp.
H00051566-Q01-10	ARMCX3 / ALEX3
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00051566-Q01-25	ARMCX3 / ALEX3
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species	Purity
H00051566-T01	ARMCX3 293T Cell Transient Overexpression Lysate(Denatured)

			Abnova Taiwan Corp.
NBL1-07716	ARMCX3 Lysate
		Protein
			Novus Biologicals Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH