AP45251PU-N ACAA2 antibody

See related secondary antibodies

Search for all "ACAA2"

0.1 ml / €430.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Chicken, Human, Mouse, Porcine, Rat, African clawed frog ACAA2

Product Description for ACAA2

Rabbit anti Bovine, Chicken, Human, Mouse, Porcine, Rat, African clawed frog ACAA2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ACAA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-ketoacyl-CoA thiolase mitochondrial, Acetyl-CoA acyltransferase, Beta-ketothiolase, Mitochondrial 3-oxoacyl-CoA thiolase, T1
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Chk, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P42765
Immunogen:
Synthetic peptide directed towards the N terminal of human ACAA2
AA Sequence:
ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV
GeneID:
10449
Application

Western blotting  (0.2 -1 µg/ml).

Background ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
General Readings Aboulaich,N., Biochem. J. 383 (PT 2), 237-248 (2004)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Horse, Bovine, Dog, Mouse, Rabbit, Rat, Pig, Guinea Pig, Zebrafish, Chicken
Species reactivity (tested):
Human.
Gene ID 10449

Accessory Products

Proteins and/or Positive Controls

Proteins for ACAA2 (7 products)

Catalog No. Species Pres. Purity   Source  

ACAA2

ACAA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACAA2 (17-397, His-tag)

ACAA2 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

ACAA2 (17-397, His-tag)

ACAA2 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

ACAA2

ACAA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACAA2

ACAA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACAA2

ACAA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACAA2

ACAA2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ACAA2 (1 products)

Catalog No. Species Pres. Purity   Source  

ACAA2 Lysate

Western Blot: ACAA2 Lysate [NBL1-07217] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ACAA2. Protein
  Novus Biologicals Inc.
  • LinkedIn