discontinued

AP44887PU-N AP3 complex subunit mu-2 / AP3M2 antibody

See related secondary antibodies

Search for all "AP3 complex subunit mu-2 / AP3M2"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog AP3 complex subunit mu-2 / AP3M2

Product Description for AP3 complex subunit mu-2 / AP3M2

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog AP3 complex subunit mu-2 / AP3M2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for AP3 complex subunit mu-2 / AP3M2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Adapter-related protein complex 3 mu-2 subunit, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, Mu3B-adaptin, P47B
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P53677
Immunogen:
Synthetic peptide directed towards the middle region of human AP3M2
AA Sequence:
VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID
GeneID:
10947
Application

Western blotting  (0.2 - 1 µg/ml).

Background AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.
General Readings Huang,M.C., (2007) Brain Dev. 29 (8), 462-467
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog, Pig, Rabbit, Chicken Xenopus, Zebrafish
Species reactivity (tested):
Human.
Gene ID 10947

Accessory Products

Proteins and/or Positive Controls

Proteins for AP3 complex subunit mu-2 / AP3M2 (2 products)

Catalog No. Species Pres. Purity   Source  

AP3 complex subunit mu-2 / AP3M2

AP3 complex subunit mu-2 / AP3M2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

AP3 complex subunit mu-2 / AP3M2

AP3 complex subunit mu-2 / AP3M2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for AP3 complex subunit mu-2 / AP3M2 (1 products)

Catalog No. Species Pres. Purity   Source  

AP3M2 293T Cell Transient Overexpression Lysate(Denatured)

AP3M2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn