discontinued

AP44890PU-N ASB8 antibody

See related secondary antibodies

Search for all "ASB8"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish ASB8

Product Description for ASB8

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish ASB8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ASB8

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ASB-8, Ankyrin repeat and SOCS box protein 8
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H765
Immunogen:
Synthetic peptide directed towards the N terminal of human ASB8
AA Sequence:
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT
GeneID:
140461
Application Western blotting (0.2 - 1 µg/ml)
Background ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
General Readings "Molecular cloning and characterization of the human ASB-8 gene encoding a novel member of ankyrin repeat and SOCS box containing protein family." Liu Y., Li J., Zhang F., Qin W., Yao G., He X., Xue P., Ge C., Wan D., Gu J. Biochem. Biophys. Res. Commun. 300:972-979(2003)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Chicken, Dog, Bovine, Zebrafish
Species reactivity (tested):
Human
Gene ID 140461

Accessory Products

Proteins and/or Positive Controls

Proteins for ASB8 (7 products)

Catalog No. Species Pres. Purity   Source  

ASB8 (full length, N-term HIS tag)

ASB8 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ASB8 (1-288, His-tag)

ASB8 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

ASB8 (1-288, His-tag)

ASB8 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

ASB8

ASB8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASB8

ASB8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASB8

ASB8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASB8

ASB8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ASB8 (2 products)

Catalog No. Species Pres. Purity   Source  

ASB8 Lysate(Denatured)

ASB8 Lysate(Denatured)
  Abnova Taiwan Corp.

ASB8 Lysate

Western Blot: ASB8 Lysate [NBL1-07755] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ASB8 Protein
  Novus Biologicals Inc.
  • LinkedIn