discontinued

AP44467PU-N ZNF669 antibody

See related secondary antibodies

Search for all "ZNF669"

Quick Overview

Rabbit anti Human ZNF669

Product Description for ZNF669

Rabbit anti Human ZNF669.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF669

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Zinc finger protein 669
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 52 kDa (464 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BR6
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF669
AA Sequence:
MVSGLRLASRSGEEGWLKPAVARLGPPRHRLRNLRTESPWRSRGSVLFCS
GeneID:
79862
Application Western blotting: 0.2-1.0 µg/ml.
Background Zinc finger protein 669, belonging to the krueppel C2H2-type zinc-finger protein family, contains 9 C2H2-type zinc fingers and 1 KRAB domain. It may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Gregory,S.G., (2006) Nature 441 (7091), 315-321.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 79862

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF669 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF669 (full length, N-term HIS tag, transcript variant 1)

ZNF669 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF669

ZNF669 Human Purified
  Abnova Taiwan Corp.

ZNF669

ZNF669 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF669 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF669 Lysate

Western Blot: ZNF669 Lysate [NBL1-18220] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF669
  Novus Biologicals Inc.
  • LinkedIn