discontinued

AP44430PU-N ZNF83 antibody

See related secondary antibodies

Search for all "ZNF83"

Quick Overview

Rabbit anti Human ZNF83

Product Description for ZNF83

Rabbit anti Human ZNF83.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF83

Product Category Primary Antibodies
Quantity 50 µg
Synonyms HPF1, ZNF816B, Zinc finger protein 816B, Zinc finger protein 83, Zinc finger protein HPF1
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 60 kDa (516 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P51522
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF8
AA Sequence:
MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS
GeneID:
55769
Application Western blotting: 0.2-1.0 µg/ml.
Background ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Crotti,T.N., (2008) J. Cell. Physiol. 215 (3), 636-644.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 55769

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF83 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF83

ZNF83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF83

ZNF83 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF83 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF83 293T Cell Transient Overexpression Lysate(Denatured)

ZNF83 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn