discontinued

AP44183PU-N ZNF773 (N-term) antibody

See related secondary antibodies

Search for all "ZNF773"

Quick Overview

Rabbit anti Human ZNF773

Product Description for ZNF773

Rabbit anti Human ZNF773.
Properties: (N-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF773

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ZNF419B, Zinc finger protein 419B, Zinc finger protein 773
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 50 kDa (442 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PK81
Immunogen:
A synthetic peptide directed towards the N-terminal region of human ZNF773
AA Sequence:
AAATLRDPAQQGYVTFEDVAVYFSQEEWRLLDDAQRLLYRNVMLENFTLL
GeneID:
374928
Property N-term
Application Western blotting: 0.2 - 1.0 µg/ml
Background Zinc finger protein 773, belonging to the krueppel C2H2-type zinc-finger protein family, may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Ota,T., (2004) Nat. Genet. 36 (1), 40-45.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 374928

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF773 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF773

ZNF773 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF773

ZNF773 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF773 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF419B 293T Cell Transient Overexpression Lysate(Denatured)

ZNF419B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF773 overexpression lysate

ZNF773 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn