discontinued

AP43253PU-N ASCC2 antibody

See related secondary antibodies

Search for all "ASCC2"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, African clawed frog ASCC2

Product Description for ASCC2

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, African clawed frog ASCC2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ASCC2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ASC-1 complex subunit p100, ASC1P100, Activating signal cointegrator 1 complex subunit 2, Trip-4 complex subunit p100
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1I8
Immunogen:
Synthetic peptide directed towards the middle region of human ASCC2
AA Sequence:
YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD
GeneID:
84164
Application Western blotting (0.2 - 1 µg/ml)
Background ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
General Readings "DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation." Dango S., Mosammaparast N., Sowa M.E., Xiong L.J., Wu F., Park K., Rubin M., Gygi S., Harper J.W., Shi Y. Mol. Cell 44:373-384(2011)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Rabbit, Chicken, Dog, Bovine, Xenopus, Guinea Pig, Horse
Species reactivity (tested):
Human
Gene ID 84164

Accessory Products

Proteins and/or Positive Controls

Proteins for ASCC2 (5 products)

Catalog No. Species Pres. Purity   Source  

ASCC2

ASCC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ASCC2

ASCC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASCC2

ASCC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ASCC2

ASCC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ASCC2

ASCC2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ASCC2 (2 products)

Catalog No. Species Pres. Purity   Source  

ASCC2 Lysate(Denatured)

ASCC2 Lysate(Denatured)
  Abnova Taiwan Corp.

ASCC2 Lysate

Western Blot: ASCC2 Lysate [NBL1-07758] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ASCC2. Protein
  Novus Biologicals Inc.
  • LinkedIn