discontinued

AP43220PU-N Arylsulfatase E antibody

See related secondary antibodies

Search for all "Arylsulfatase E"

Quick Overview

Rabbit anti Human Arylsulfatase E

Product Description for Arylsulfatase E

Rabbit anti Human Arylsulfatase E.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Arylsulfatase E

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ARSE, ASE
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P51690
Immunogen:
Synthetic peptide directed towards the middle region of human ARSE
AA Sequence:
KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS
GeneID:
415
Application Western blotting (0.2 -1 µg/ml).
Background Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.
General Readings Nino,M., (2008) Am. J. Med. Genet. A 146 (8), 997-1008
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 415

Accessory Products

Proteins and/or Positive Controls

Proteins for Arylsulfatase E (3 products)

Catalog No. Species Pres. Purity   Source  

Arylsulfatase E

Arylsulfatase E Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Arylsulfatase E

Arylsulfatase E Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Arylsulfatase E

Arylsulfatase E Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Arylsulfatase E (1 products)

Catalog No. Species Pres. Purity   Source  

ARSE overexpression lysate

ARSE overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn