ADAT1

Product Description for ADAT1

Rabbit anti Canine, Human, Mouse, Rat ADAT1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	50 µg
Synonyms	hADAT1, tRNA-specific adenosine deaminase 1
Presentation	Aff - Purified
Reactivity	Can, Hu, Ms, Rt
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q9BUB4 Immunogen: Synthetic peptide directed towards the C terminal of human ADAT1 AA Sequence: `LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV` GeneID: 23536
Application	Western blotting (0.2 - 1.0 µg/ml)
Background	ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.
General Readings	Maas,S., (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (16), 8895-8900
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Purified using peptide immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (expected): Mouse, Rat Species reactivity (tested): Human
Gene ID	23536

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH