discontinued

AP42936PU-N ARGFX antibody

See related secondary antibodies

Search for all "ARGFX"

Quick Overview

Rabbit anti Drosophila, Human ARGFX

Product Description for ARGFX

Rabbit anti Drosophila, Human ARGFX.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ARGFX

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Arginine-fifty homeobox
Presentation Aff - Purified
Reactivity Dros, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJG6
Immunogen:
Synthetic peptide directed towards the N terminal of human ARGFX
AA Sequence:
MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP
GeneID:
503582
Application

Western blotting  (1 - 3 µg/ml).

Background Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. ARGFX gene is a member of the paired homeobox family expressed at low level in testis and undifferentiated embryonic stem cells
General Readings "Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line." Booth H.A., Holland P.W.H. Gene 387:7-14(2007)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human.
Gene ID 503582

Accessory Products

Proteins and/or Positive Controls

Proteins for ARGFX (2 products)

Catalog No. Species Pres. Purity   Source  

ARGFX

ARGFX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARGFX

ARGFX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ARGFX (2 products)

Catalog No. Species Pres. Purity   Source  

ARGFX 293T Cell Transient Overexpression Lysate(Denatured)

ARGFX 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ARGFX overexpression lysate

ARGFX overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn