discontinued

AP42505PU-N ZNF660 antibody

See related secondary antibodies

Search for all "ZNF660"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat ZNF660

AP42505PU-N

More Views

  • AP42505PU-N

Product Description for ZNF660

Rabbit anti Canine, Human, Mouse, Rat ZNF660.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF660

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Zinc finger protein 660
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Molecular weight 38 kDa (331 aa)
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6AZW8
Immunogen:
A synthetic peptide directed towards the C-terminal region of human ZNF660
AA Sequence:
TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQRKHNEEKETS
GeneID:
285349
Application Western blotting: 1.0 - 2.0 µg/ml.
Immunohistochemistry on paraffin embedded tissues:  4.0-8.0 µg/ml.
Background Zinc finger protein 660, belonging to the krueppel C2H2-type zinc-finger protein family, contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
Concentration 1.0 mg/ml after reconstitution
General Readings Strausberg R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human, Mouse, Rat, Dog
Gene ID 285349

Accessory Products

  • LinkedIn