discontinued

AP42304PU-N ONECUT3 antibody

See related secondary antibodies

Search for all "ONECUT3"

Quick Overview

Rabbit anti Canine, Human, Mouse ONECUT3

Product Description for ONECUT3

Rabbit anti Canine, Human, Mouse ONECUT3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ONECUT3

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms One cut domain family member 3, One cut homeobox 3, Transcription factor ONECUT-3
Presentation Purified
Reactivity Can, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O60422
Immunogen:
The immunogen for anti-ONECUT3 antibody: synthetic peptide directed towards the C terminal of human ONECUT3.
AA Sequence:
ETFRRMWKWLQEPEFQRMSALRLAACKRKEQEQQKERALQPKKQRLVFTD
GeneID:
390874
Application Western blotting (1 - 3 µg/ml)
Background ONECUT3 ia a transcriptional activator and binds the consensus DNA sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR.
General Readings "OC-3, a novel mammalian member of the ONECUT class of transcription factors." Vanhorenbeeck V., Jacquemin P., Lemaigre F.P., Rousseau G.G. Biochem. Biophys. Res. Commun. 292:848-854(2002)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purified
Species Reactivity
Species reactivity (expected):
Mouse, Dog
Species reactivity (tested):
Human
Gene ID 390874

Accessory Products

Proteins and/or Positive Controls

Positive controls for ONECUT3 (1 products)

Catalog No. Species Pres. Purity   Source  

ONECUT3 overexpression lysate

ONECUT3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn