discontinued

AP42257PU-N ZNF179 antibody

See related secondary antibodies

Search for all "ZNF179"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF179

Product Description for ZNF179

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF179.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF179

Product Category Primary Antibodies
Quantity 50 µg
Synonyms BFP, Brain finger protein, RING finger protein 112, RNF112, Zinc finger protein 179
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9ULX5
Immunogen:
The immunogen for anti-ZNF179 antibody: synthetic peptide directed towards the C terminal of human ZNF179
AA Sequence:
GVALLCKGRDQTLEALEAELQATAKAFMDSYTMRFCGHLAAVGGAVGAGL
GeneID:
7732
Application

Western blotting (0.2 - 1 µg/ml)

Background ZNF179 encodes a member of the RING finger protein family of transcription factors (RNF112). The protein is primarily expressed in brain. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
General Readings Seki,N., et al., (1999) DNA Res. 6 (5), 353-356
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog
Species reactivity (tested):
Human
Gene ID 7732

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF179 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF179

ZNF179 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ZNF179 (2 products)

Catalog No. Species Pres. Purity   Source  

RNF112 overexpression lysate

RNF112 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF179 Lysate

Western Blot: ZNF179 Lysate [NBL1-15410] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for RNF12.
  Novus Biologicals Inc.
  • LinkedIn