SNAPC3 / SNAP50

Product Description for SNAPC3 / SNAP50

Rabbit anti Bovine, Canine, Human, Mouse, Rat SNAPC3 / SNAP50.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	50 µg
Synonyms	PSE-binding factor subunit beta, SNAP-50, SNAPc subunit 3, Small nuclear RNA-activating complex polypeptide 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3
Presentation	Aff - Purified
Reactivity	Bov, Can, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q92966 Immunogen: The immunogen for anti-SNAPC3 antibody: synthetic peptide directed towards the middle region of human SNAPC3 AA Sequence: `LRDSIRCVSDLQIGGEFSNTPDQAPEHISKDLYKSAFFYFEGTFYNDKRY` GeneID: 6619
Application	Western blotting (0.2 - 1 µg/ml)
Background	SNAPC3 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box.
General Readings	"The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition." Hinkley C.S., Hirsch H.A., Gu L., LaMere B., Henry R.W. J. Biol. Chem. 278:18649-18657(2003)
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Purified using peptide immunoaffinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (expected): Mouse, Rat, Bovine, Dog Species reactivity (tested): Human
Gene ID	6619

Catalog No.	Species	Pres.	Purity	Source
TP760950	SNAPC3 / SNAP50 (full length, N-term HIS tag)
	Human		> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / €205.00
					OriGene Technologies, Inc.
H00006619-Q01-10	SNAPC3 / SNAP50
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00006619-Q01-25	SNAPC3 / SNAP50
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.

Catalog No.	Species
H00006619-T01	SNAPC3 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
NBL1-16272	SNAPC3 Lysate

		Novus Biologicals Inc.
LY421891	SNAPC3 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH