discontinued

AP42266PU-N PDLIM5 antibody

See related secondary antibodies

Search for all "PDLIM5"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat PDLIM5

Product Description for PDLIM5

Rabbit anti Bovine, Canine, Human, Mouse, Rat PDLIM5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PDLIM5

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms ENH, Enigma homolog, Enigma-like PDZ and LIM domains protein
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96HC4
Immunogen:
The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the middle region of human PDLIM5
AA Sequence:
RTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVAST
GeneID:
10611
Application

Western blotting (1 - 3 µg/ml)

Background PDLIM5 is a LIM domain protein. LIM domains are cysteine-rich double zinc fingers composed of 50 to 60 amino acids that are involved in protein-protein interactions. LIM domain-containing proteins are scaffolds for the formation of multiprotein complexes. The proteins are involved in cytoskeleton organization, cell lineage specification, organ development, and oncogenesis. The encoded protein is also a member of the Enigma class of proteins, a family of proteins that possess a 100-amino acid PDZ domain in the N terminus and 1 to 3 LIM domains in the C terminus. Multiple transcript variants encoding different isoforms have been found for this gene, although not all of them have been fully characterized.
General Readings Lasorella,A., et al., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (13), 4976-4981
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog
Species reactivity (tested):
Human
Gene ID 10611

Accessory Products

Proteins and/or Positive Controls

Proteins for PDLIM5 (3 products)

Catalog No. Species Pres. Purity   Source  

PDLIM5 (transcript variant 1)

PDLIM5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PDLIM5

PDLIM5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDLIM5

PDLIM5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PDLIM5 (1 products)

Catalog No. Species Pres. Purity   Source  

PDLIM5 Lysate

Western Blot: PDLIM5 Lysate [NBL1-14257] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDLIM5
  Novus Biologicals Inc.
  • LinkedIn