discontinued

AP42145PU-N TRAFD1 / FLN29 antibody

See related secondary antibodies

Search for all "TRAFD1 / FLN29"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat TRAFD1 / FLN29

AP42145PU-N

More Views

  • AP42145PU-N

Product Description for TRAFD1 / FLN29

Rabbit anti Bovine, Canine, Human, Mouse, Rat TRAFD1 / FLN29.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TRAFD1 / FLN29

Product Category Primary Antibodies
Quantity 50 µg
Synonyms TRAF-type zinc finger domain-containing protein 1
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O14545
Immunogen:
The immunogen for anti-TRAFD1 antibody: synthetic peptide directed towards the C terminal of human TRAFD1.
AA Sequence:
TATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANG
GeneID:
10906
Application Western blotting (0.2 - 1.0 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background TRAFD1 is a negative feedback regulator that controls excessive innate immune responses. It regulates both Toll-like receptor 4 (TLR4) and DDX58/RIG1-like helicases (RLH) pathways and may inhibit the LTR pathway by direct interaction with TRAF6 and attenuation of NF-kappa-B activation. TRAFD1 may negatively regulate the RLH pathway downstream from MAVS and upstream of NF-kappa-B and IRF3.
General Readings Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Rat, Mouse, Dog, Bovine
Species reactivity (tested):
Human
Gene ID 10906

Accessory Products

Proteins and/or Positive Controls

Proteins for TRAFD1 / FLN29 (1 products)

Catalog No. Species Pres. Purity   Source  

TRAFD1 / FLN29 (transcript variant 1)

TRAFD1 / FLN29 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TRAFD1 / FLN29 (1 products)

Catalog No. Species Pres. Purity   Source  

TRAFD1 Lysate

Western Blot: TRAFD1 Lysate [NBL1-17249] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRAFD1
  Novus Biologicals Inc.
  • LinkedIn