discontinued

AP42268PU-N GTL3 / C16orf80 antibody

See related secondary antibodies

Search for all "GTL3 / C16orf80"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog GTL3 / C16orf80

Product Description for GTL3 / C16orf80

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog GTL3 / C16orf80.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GTL3 / C16orf80

Product Category Primary Antibodies
Quantity 50 µg
Synonyms EVORF, UPF0468 protein C16orf80
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6A4
Immunogen:
The immunogen for anti-GTL3 antibody: synthetic peptide directed towards the C terminal of human GTL3
AA Sequence:
YGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
GeneID:
29105
Application

Western blotting (0.2 - 1 µg/ml)

Background GTL3 or better known as C16orf80 is a protein belonging to the UPF0468 protein family. It is a 193 amino acid 23 kDa protein with so far unknown function.
General Readings Rijkers,T. et al., (1996) Biochim. Biophys. Acta 1307 (3), 294-300
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Dog, ZebraFish, Rat, African clawed frog, Bovine, Chicken
Species reactivity (tested):
Human
Gene ID 29105

Accessory Products

Proteins and/or Positive Controls

Proteins for GTL3 / C16orf80 (1 products)

Catalog No. Species Pres. Purity   Source  

GTL3 / C16orf80

GTL3 / C16orf80 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for GTL3 / C16orf80 (1 products)

Catalog No. Species Pres. Purity   Source  

CFAP20 overexpression lysate

CFAP20 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn