discontinued

AP42272PU-N SERTAD1 / SEI1 antibody

See related secondary antibodies

Search for all "SERTAD1 / SEI1"

Quick Overview

Rabbit anti Bovine, Drosophila, Human, Mouse, Rat SERTAD1 / SEI1

Product Description for SERTAD1 / SEI1

Rabbit anti Bovine, Drosophila, Human, Mouse, Rat SERTAD1 / SEI1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for SERTAD1 / SEI1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CDK4-binding protein p34SEI1, SEI-1, SERTA domain-containing protein 1, TRIP-Br1, Transcriptional regulator interacting with the PHD-bromodomain 1
Presentation Aff - Purified
Reactivity Bov, Dros, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHV2
Immunogen:
The immunogen for anti-SERTAD1 antibody: synthetic peptide directed towards the N terminal of human SERTAD1
AA Sequence:
MLSKGLKRKREEEEEKEPLAVDSWWLDPGHTAVAQAPPAVASSSLFDLSV
GeneID:
29950
Application Western blotting (0.2 - 1 µg/ml)
Background SERTA is a transcriptional regulator that interacts with the PHD-bromodomain of co-repressors of Kruppel-associated box (KRAB)-mediated repression, KRIP-1(TIF1beta) and TIF1alpha, as well as the co-activator/adaptor p300/CBP. It is a component of a multiprotein complex containing E2F-1 and DP-1.
General Readings Li,J., et al., (2005) Biochemistry 44 (40), 13246-13256
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Drosophila, Bovine
Species reactivity (tested):
Human
Gene ID 29950

Accessory Products

Proteins and/or Positive Controls

Proteins for SERTAD1 / SEI1 (5 products)

Catalog No. Species Pres. Purity   Source  

SERTAD1 / SEI1 (1-236, His-tag)

SERTAD1 / SEI1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €820.00
  OriGene Technologies GmbH

SERTAD1 / SEI1 (1-236, His-tag)

SERTAD1 / SEI1 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €320.00
  OriGene Technologies GmbH

SERTAD1 / SEI1

SERTAD1 / SEI1 Human in vitro transl.
  Abnova Taiwan Corp.

SERTAD1 / SEI1

SERTAD1 / SEI1 Human in vitro transl.
  Abnova Taiwan Corp.

SERTAD1 / SEI1

SERTAD1 / SEI1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SERTAD1 / SEI1 (1 products)

Catalog No. Species Pres. Purity   Source  

Sertad1 Lysate

Western Blot: Sertad1 Lysate [NBL1-15859] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SERTAD1
  Novus Biologicals Inc.
  • LinkedIn